![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (5 proteins) |
![]() | Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [102261] (5 PDB entries) TM0379 |
![]() | Domain d1s4mb2: 1s4m B:301-458 [112026] Other proteins in same PDB: d1s4ma1, d1s4mb1 complexed with lum, mg |
PDB Entry: 1s4m (more details), 2.1 Å
SCOP Domain Sequences for d1s4mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4mb2 c.26.1.3 (B:301-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima} mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv evyeiedvvvqgkrvssslirnlvqegrveeipaylgr
Timeline for d1s4mb2: