Lineage for d1s4mb1 (1s4m B:459-589)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054942Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2054943Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 protein domains)
    automatically mapped to Pfam PF01687
  6. 2054959Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 2054960Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 2054964Domain d1s4mb1: 1s4m B:459-589 [112025]
    Other proteins in same PDB: d1s4ma2, d1s4mb2
    complexed with lum, mg

Details for d1s4mb1

PDB Entry: 1s4m (more details), 2.1 Å

PDB Description: crystal structure of flavin binding to fad synthetase from thermotoga maritina
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1s4mb1:

Sequence, based on SEQRES records: (download)

>d1s4mb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records): (download)

>d1s4mb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyil
dfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

SCOPe Domain Coordinates for d1s4mb1:

Click to download the PDB-style file with coordinates for d1s4mb1.
(The format of our PDB-style files is described here.)

Timeline for d1s4mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s4mb2