| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
| Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries) Uniprot Q9WZW1 TM0379 |
| Domain d1s4ma2: 1s4m A:1-158 [112024] Other proteins in same PDB: d1s4ma1, d1s4mb1 complexed with lum, mg |
PDB Entry: 1s4m (more details), 2.1 Å
SCOPe Domain Sequences for d1s4ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4ma2 c.26.1.3 (A:1-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
evyeiedvvvqgkrvssslirnlvqegrveeipaylgr
Timeline for d1s4ma2: