Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) [117736] (2 species) |
Species Pseudomonas denitrificans [TaxId:43306] [117737] (1 PDB entry) Uniprot P21631 |
Domain d1s4dl_: 1s4d L: [112021] complexed with gol, sah |
PDB Entry: 1s4d (more details), 2.7 Å
SCOPe Domain Sequences for d1s4dl_:
Sequence, based on SEQRES records: (download)
>d1s4dl_ c.90.1.1 (L:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]} aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef agkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfriv pgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvivmymam khigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvg evvrlraaldwiga
>d1s4dl_ c.90.1.1 (L:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]} aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef agkggkpskqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpg itagigglayagipvthrevnhavtfltghvpdrinwqgiasgspvivmymamkhigait anliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlra aldwiga
Timeline for d1s4dl_: