Lineage for d1s4di_ (1s4d I:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2142837Family c.90.1.1: Tetrapyrrole methylase [53791] (8 protein domains)
    Pfam PF00590
  6. 2143025Protein Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) [117736] (2 species)
  7. 2143026Species Pseudomonas denitrificans [TaxId:43306] [117737] (1 PDB entry)
    Uniprot P21631
  8. 2143034Domain d1s4di_: 1s4d I: [112018]
    complexed with gol, sah

Details for d1s4di_

PDB Entry: 1s4d (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT
PDB Compounds: (I:) Uroporphyrin-III C-methyltransferase

SCOPe Domain Sequences for d1s4di_:

Sequence, based on SEQRES records: (download)

>d1s4di_ c.90.1.1 (I:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]}
dlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgav
lefagkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpf
rivpgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvivmy
mamkhigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaiv
vvgevvrlraaldwigaldgrklaad

Sequence, based on observed residues (ATOM records): (download)

>d1s4di_ c.90.1.1 (I:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans [TaxId: 43306]}
dlfaglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgav
lefagkrggpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfr
ivpgitagigglayagipvthrevnhavtfltghdssvpdrinwqgiasgspvivmymam
khigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvg
evvrlraaldwigaldgrklaad

SCOPe Domain Coordinates for d1s4di_:

Click to download the PDB-style file with coordinates for d1s4di_.
(The format of our PDB-style files is described here.)

Timeline for d1s4di_: