Lineage for d1s4df_ (1s4d F:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592992Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 592993Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 592994Family c.90.1.1: Tetrapyrrole methylase [53791] (4 proteins)
    Pfam 00590
  6. 593013Protein Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) [117736] (1 species)
  7. 593014Species Pseudomonas denitrificans [TaxId:43306] [117737] (1 PDB entry)
  8. 593019Domain d1s4df_: 1s4d F: [112015]

Details for d1s4df_

PDB Entry: 1s4d (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT

SCOP Domain Sequences for d1s4df_:

Sequence, based on SEQRES records: (download)

>d1s4df_ c.90.1.1 (F:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans}
aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef
agkrggkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfriv
pgitagigglayagipvthrevnhavtfltghdssglvpdrinwqgiasgspvivmymam
khigaitanliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvg
evvrlraaldwigaldgrklaad

Sequence, based on observed residues (ATOM records): (download)

>d1s4df_ c.90.1.1 (F:) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Pseudomonas denitrificans}
aglpalekgsvwlvgagpgdpglltlhaanalrqadvivhdalvnedclklarpgavlef
agkkpspkqrdislrlvelaragnrvlrlkggdpfvfgrggeealtlvehqvpfrivpgi
tagigglayagipvthrevnhavtfltghvpdrinwqgiasgspvivmymamkhigaita
nliaggrspdepvafvcnaatpqqavlettlaraeadvaaagleppaivvvgevvrlraa
ldwigadgrklaad

SCOP Domain Coordinates for d1s4df_:

Click to download the PDB-style file with coordinates for d1s4df_.
(The format of our PDB-style files is described here.)

Timeline for d1s4df_: