Lineage for d1s36a_ (1s36 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2323758Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 2323761Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (8 PDB entries)
    Uniprot Q27709
  8. 2323769Domain d1s36a_: 1s36 A: [112009]
    complexed with cei, cl, gol, na

Details for d1s36a_

PDB Entry: 1s36 (more details), 1.96 Å

PDB Description: crystal structure of a ca2+-discharged photoprotein: implications for the mechanisms of the calcium trigger and the bioluminescence
PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d1s36a_:

Sequence, based on SEQRES records: (download)

>d1s36a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
vklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqv
cveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkdg
sgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpea
dglygngvp

Sequence, based on observed residues (ATOM records): (download)

>d1s36a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
vklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqv
cveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdgti
tldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadgly
gngvp

SCOPe Domain Coordinates for d1s36a_:

Click to download the PDB-style file with coordinates for d1s36a_.
(The format of our PDB-style files is described here.)

Timeline for d1s36a_: