Lineage for d1s1fa1 (1s1f A:8-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2007942Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2008023Protein Cyp158a2 [116991] (1 species)
  7. 2008024Species Streptomyces coelicolor [TaxId:1902] [116992] (1 PDB entry)
    Uniprot Q9FCA6
  8. 2008025Domain d1s1fa1: 1s1f A:8-404 [112008]
    Other proteins in same PDB: d1s1fa2
    complexed with gol, hem, hg, mla, pim

Details for d1s1fa1

PDB Entry: 1s1f (more details), 1.5 Å

PDB Description: crystal structure of streptomyces coelicolor a3(2) cyp158a2 from antibiotic biosynthetic pathways
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d1s1fa1:

Sequence, based on SEQRES records: (download)

>d1s1fa1 a.104.1.1 (A:8-404) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}
qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
iragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlesellv
davldrvpglklavapedvpfkkgalirgpealpvtw

Sequence, based on observed residues (ATOM records): (download)

>d1s1fa1 a.104.1.1 (A:8-404) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}
qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
iragdavyvsylaanrdpevfpdpdridfernphvsfgfgphycpggmlarlesellvda
vldrvpglklavapedvpfkkgalirgpealpvtw

SCOPe Domain Coordinates for d1s1fa1:

Click to download the PDB-style file with coordinates for d1s1fa1.
(The format of our PDB-style files is described here.)

Timeline for d1s1fa1:

Domains from same chain:
(mouse over for more information)
d1s1fa2