Lineage for d1s1fa_ (1s1f A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499257Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1499320Protein Cyp158a2 [116991] (1 species)
  7. 1499321Species Streptomyces coelicolor [TaxId:1902] [116992] (1 PDB entry)
    Uniprot Q9FCA6
  8. 1499322Domain d1s1fa_: 1s1f A: [112008]
    complexed with gol, hem, hg, mla, pim

Details for d1s1fa_

PDB Entry: 1s1f (more details), 1.5 Å

PDB Description: crystal structure of streptomyces coelicolor a3(2) cyp158a2 from antibiotic biosynthetic pathways
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d1s1fa_:

Sequence, based on SEQRES records: (download)

>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}
qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
iragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlesellv
davldrvpglklavapedvpfkkgalirgpealpvtwha

Sequence, based on observed residues (ATOM records): (download)

>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}
qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
iragdavyvsylaanrdpevfpdpdridfernphvsfgfgphycpggmlarlesellvda
vldrvpglklavapedvpfkkgalirgpealpvtwha

SCOPe Domain Coordinates for d1s1fa_:

Click to download the PDB-style file with coordinates for d1s1fa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1fa_: