Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [116902] (1 PDB entry) Uniprot Q9NZI2 |
Domain d1s1ea1: 1s1e A:38-216 [112007] Other proteins in same PDB: d1s1ea2 complexed with ca |
PDB Entry: 1s1e (more details), 2.3 Å
SCOPe Domain Sequences for d1s1ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1ea1 a.39.1.5 (A:38-216) Kchip1, Kv4 potassium channel-interacting protein {Human (Homo sapiens) [TaxId: 9606]} gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm
Timeline for d1s1ea1: