Lineage for d1s1ea_ (1s1e A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 641101Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species)
  7. 641102Species Human (Homo sapiens) [TaxId:9606] [116902] (1 PDB entry)
  8. 641103Domain d1s1ea_: 1s1e A: [112007]
    complexed with ca

Details for d1s1ea_

PDB Entry: 1s1e (more details), 2.3 Å

PDB Description: Crystal Structure of Kv Channel-interacting protein 1 (KChIP-1)
PDB Compounds: (A:) Kv channel interacting protein 1

SCOP Domain Sequences for d1s1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ea_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Human (Homo sapiens) [TaxId: 9606]}
gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna
fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm
mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvmv
e

SCOP Domain Coordinates for d1s1ea_:

Click to download the PDB-style file with coordinates for d1s1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ea_: