SCOP 1.71: Domain d1s1ea_: 1s1e A:

Lineage for d1s1ea_ (1s1e A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116902] (1 PDB entry)

8. Domain d1s1ea_: 1s1e A: [112007]
   complexed with ca

Details for d1s1ea_

PDB Entry: 1s1e, 2.3 Å

PDB Description: Crystal Structure of Kv Channel-interacting protein 1 (KChIP-1)

SCOP Domain Sequences for d1s1ea_:

Sequence; same for both SEQRES and ATOM records:

>d1s1ea_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Human (Homo sapiens)}
gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna
fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm
mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvmv
e

Timeline for d1s1ea_:

• d1s1ea_ is new in SCOP 1.71
  
• d1s1ea_ appears in SCOP 1.73
  
• d1s1ea_ appears in the current release, SCOPe 2.08, called d1s1ea1