Lineage for d1s1ea1 (1s1e A:38-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711035Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species)
  7. 2711036Species Human (Homo sapiens) [TaxId:9606] [116902] (1 PDB entry)
    Uniprot Q9NZI2
  8. 2711037Domain d1s1ea1: 1s1e A:38-216 [112007]
    Other proteins in same PDB: d1s1ea2
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1s1ea1

PDB Entry: 1s1e (more details), 2.3 Å

PDB Description: Crystal Structure of Kv Channel-interacting protein 1 (KChIP-1)
PDB Compounds: (A:) Kv channel interacting protein 1

SCOPe Domain Sequences for d1s1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ea1 a.39.1.5 (A:38-216) Kchip1, Kv4 potassium channel-interacting protein {Human (Homo sapiens) [TaxId: 9606]}
gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna
fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm
mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

SCOPe Domain Coordinates for d1s1ea1:

Click to download the PDB-style file with coordinates for d1s1ea1.
(The format of our PDB-style files is described here.)

Timeline for d1s1ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1ea2