SCOPe 2.08: Domain d1s1ea1: 1s1e A:38-216

Lineage for d1s1ea1 (1s1e A:38-216)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Kchip1, Kv4 potassium channel-interacting protein [101184] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116902] (1 PDB entry)
   Uniprot Q9NZI2

8. Domain d1s1ea1: 1s1e A:38-216 [112007]
   Other proteins in same PDB: d1s1ea2
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d1s1ea1

PDB Entry: 1s1e, 2.3 Å

PDB Description: Crystal Structure of Kv Channel-interacting protein 1 (KChIP-1)

PDB Compounds: (A:) Kv channel interacting protein 1

SCOPe Domain Sequences for d1s1ea1:

Sequence; same for both SEQRES and ATOM records:

>d1s1ea1 a.39.1.5 (A:38-216) Kchip1, Kv4 potassium channel-interacting protein {Human (Homo sapiens) [TaxId: 9606]}
gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna
fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm
mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvm

Timeline for d1s1ea1:

• d1s1ea1 first appeared in SCOP 1.71, called d1s1ea_
  
• d1s1ea1 appears in SCOPe 2.07