Lineage for d1s12d_ (1s12 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956745Fold d.64: eIF1-like [55158] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243
  4. 2956754Superfamily d.64.2: TM1457-like [118010] (1 family) (S)
    forms a homodimer via alpha-helical interface
    automatically mapped to Pfam PF04327
  5. 2956755Family d.64.2.1: TM1457-like [118011] (5 proteins)
    Pfam PF04327; DUF464
  6. 2956771Protein Hypothetical protein TM1457 [118012] (1 species)
  7. 2956772Species Thermotoga maritima [TaxId:2336] [118013] (1 PDB entry)
    Uniprot Q9X1G8
  8. 2956776Domain d1s12d_: 1s12 D: [112006]
    Structural genomics target
    complexed with act

Details for d1s12d_

PDB Entry: 1s12 (more details), 2 Å

PDB Description: Crystal structure of TM1457
PDB Compounds: (D:) hypothetical protein TM1457

SCOPe Domain Sequences for d1s12d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s12d_ d.64.2.1 (D:) Hypothetical protein TM1457 {Thermotoga maritima [TaxId: 2336]}
mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
ncevkvlaamvrslkeleqkfpsqirvevid

SCOPe Domain Coordinates for d1s12d_:

Click to download the PDB-style file with coordinates for d1s12d_.
(The format of our PDB-style files is described here.)

Timeline for d1s12d_: