Lineage for d1s12c_ (1s12 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605337Fold d.64: eIF1-like [55158] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243
  4. 605346Superfamily d.64.2: Hypothetical protein TM1457 [118010] (1 family) (S)
    forms a homodimer via alpha-helical interface
  5. 605347Family d.64.2.1: Hypothetical protein TM1457 [118011] (1 protein)
    Pfam 04327; DUF464
  6. 605348Protein Hypothetical protein TM1457 [118012] (1 species)
  7. 605349Species Thermotoga maritima [TaxId:243274] [118013] (1 PDB entry)
  8. 605352Domain d1s12c_: 1s12 C: [112005]

Details for d1s12c_

PDB Entry: 1s12 (more details), 2 Å

PDB Description: Crystal structure of TM1457

SCOP Domain Sequences for d1s12c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s12c_ d.64.2.1 (C:) Hypothetical protein TM1457 {Thermotoga maritima}
mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
ncevkvlaamvrslkeleqkfpsqirvevid

SCOP Domain Coordinates for d1s12c_:

Click to download the PDB-style file with coordinates for d1s12c_.
(The format of our PDB-style files is described here.)

Timeline for d1s12c_: