Lineage for d1s12a_ (1s12 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563473Fold d.64: eIF1-like [55158] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243
  4. 2563482Superfamily d.64.2: TM1457-like [118010] (1 family) (S)
    forms a homodimer via alpha-helical interface
    automatically mapped to Pfam PF04327
  5. 2563483Family d.64.2.1: TM1457-like [118011] (5 proteins)
    Pfam PF04327; DUF464
  6. 2563499Protein Hypothetical protein TM1457 [118012] (1 species)
  7. 2563500Species Thermotoga maritima [TaxId:2336] [118013] (1 PDB entry)
    Uniprot Q9X1G8
  8. 2563501Domain d1s12a_: 1s12 A: [112003]
    Structural genomics target
    complexed with act

Details for d1s12a_

PDB Entry: 1s12 (more details), 2 Å

PDB Description: Crystal structure of TM1457
PDB Compounds: (A:) hypothetical protein TM1457

SCOPe Domain Sequences for d1s12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s12a_ d.64.2.1 (A:) Hypothetical protein TM1457 {Thermotoga maritima [TaxId: 2336]}
mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
ncevkvlaamvrslkeleqkfpsqirvevidngs

SCOPe Domain Coordinates for d1s12a_:

Click to download the PDB-style file with coordinates for d1s12a_.
(The format of our PDB-style files is described here.)

Timeline for d1s12a_: