Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
Superfamily d.64.2: Hypothetical protein TM1457 [118010] (1 family) forms a homodimer via alpha-helical interface |
Family d.64.2.1: Hypothetical protein TM1457 [118011] (1 protein) Pfam 04327; DUF464 |
Protein Hypothetical protein TM1457 [118012] (1 species) |
Species Thermotoga maritima [TaxId:243274] [118013] (1 PDB entry) |
Domain d1s12a_: 1s12 A: [112003] |
PDB Entry: 1s12 (more details), 2 Å
SCOP Domain Sequences for d1s12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s12a_ d.64.2.1 (A:) Hypothetical protein TM1457 {Thermotoga maritima} mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele ncevkvlaamvrslkeleqkfpsqirvevidngs
Timeline for d1s12a_: