![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
![]() | Superfamily d.64.2: TM1457-like [118010] (1 family) ![]() forms a homodimer via alpha-helical interface automatically mapped to Pfam PF04327 |
![]() | Family d.64.2.1: TM1457-like [118011] (5 proteins) Pfam PF04327; DUF464 |
![]() | Protein Hypothetical protein TM1457 [118012] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [118013] (1 PDB entry) Uniprot Q9X1G8 |
![]() | Domain d1s12a_: 1s12 A: [112003] Structural genomics target complexed with act |
PDB Entry: 1s12 (more details), 2 Å
SCOPe Domain Sequences for d1s12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s12a_ d.64.2.1 (A:) Hypothetical protein TM1457 {Thermotoga maritima [TaxId: 2336]} mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele ncevkvlaamvrslkeleqkfpsqirvevidngs
Timeline for d1s12a_: