SCOPe 2.03: Domain d1s04a_: 1s04 A:

Lineage for d1s04a_ (1s04 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins)
   Pfam PF07060; DUF1530

6. Protein Hypothetical protein PF0455 [117354] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [117355] (1 PDB entry)
   Uniprot Q8U3L1

8. Domain d1s04a_: 1s04 A: [112002]
   Structural genomics target

Details for d1s04a_

PDB Entry: 1s04

PDB Description: solution nmr structure of protein pf0455 from pyrococcus furiosus. northeast structural genomics consortium target pfr13

PDB Compounds: (A:) hypothetical protein PF0455

SCOPe Domain Sequences for d1s04a_:

Sequence; same for both SEQRES and ATOM records:

>d1s04a_ b.122.1.6 (A:) Hypothetical protein PF0455 {Pyrococcus furiosus [TaxId: 2261]}
mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsf
remlekeglenvlpgvksieegiqvyrrfydeekekkygvvaieiepley

Timeline for d1s04a_:

• d1s04a_ first appeared in SCOP 1.71
  
• d1s04a_ appears in SCOPe 2.02
  
• d1s04a_ appears in SCOPe 2.04
  
• d1s04a_ appears in the current release, SCOPe 2.08