![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (7 families) ![]() |
![]() | Family b.122.1.6: ProFAR isomerase associated domain [117351] (2 proteins) Pfam 07060; DUF1530 |
![]() | Protein Hypothetical protein PF0455 [117354] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:186497] [117355] (1 PDB entry) |
![]() | Domain d1s04a_: 1s04 A: [112002] Structural genomics target |
PDB Entry: 1s04 (more details)
SCOP Domain Sequences for d1s04a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s04a_ b.122.1.6 (A:) Hypothetical protein PF0455 {Pyrococcus furiosus} mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsf remlekeglenvlpgvksieegiqvyrrfydeekekkygvvaieiepley
Timeline for d1s04a_: