SCOPe 2.06: Domain d1rzoc_: 1rzo C:

Lineage for d1rzoc_ (1rzo C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Ricin A-chain [56389] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (48 PDB entries)
   Uniprot P06750 28-286

8. Domain d1rzoc_: 1rzo C: [111986]
   Other proteins in same PDB: d1rzob1, d1rzob2, d1rzod1, d1rzod2
   complexed with gal, so4

Details for d1rzoc_

PDB Entry: 1rzo, 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza

PDB Compounds: (C:) agglutinin

SCOPe Domain Sequences for d1rzoc_:

Sequence; same for both SEQRES and ATOM records:

>d1rzoc_ d.165.1.1 (C:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
pkqypiinfttadatvesytnfiravrshlttgadvrheipvlpnrvglpisqrfilvel
snhaelsvtlaldvtnayvvgcragnsayffhpdnqedaeaithlftdvqnsftfafggn
ydrleqlgglrenielgtgpledaisalyyystcgtqiptlarsfmvciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfnvy
dvsilipiialmvyrcappp

Timeline for d1rzoc_:

• d1rzoc_ first appeared in SCOP 1.71
  
• d1rzoc_ appears in SCOPe 2.05
  
• d1rzoc_ appears in SCOPe 2.07
  
• d1rzoc_ appears in the current release, SCOPe 2.08