Lineage for d1rzoc_ (1rzo C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000077Protein Ricin A-chain [56389] (1 species)
  7. 3000078Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (55 PDB entries)
    Uniprot P06750 28-286
  8. 3000130Domain d1rzoc_: 1rzo C: [111986]
    Other proteins in same PDB: d1rzob1, d1rzob2, d1rzod1, d1rzod2
    complexed with gal, so4

Details for d1rzoc_

PDB Entry: 1rzo (more details), 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza
PDB Compounds: (C:) agglutinin

SCOPe Domain Sequences for d1rzoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzoc_ d.165.1.1 (C:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
pkqypiinfttadatvesytnfiravrshlttgadvrheipvlpnrvglpisqrfilvel
snhaelsvtlaldvtnayvvgcragnsayffhpdnqedaeaithlftdvqnsftfafggn
ydrleqlgglrenielgtgpledaisalyyystcgtqiptlarsfmvciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfnvy
dvsilipiialmvyrcappp

SCOPe Domain Coordinates for d1rzoc_:

Click to download the PDB-style file with coordinates for d1rzoc_.
(The format of our PDB-style files is described here.)

Timeline for d1rzoc_: