![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.28: RecU-like [117631] (2 proteins) Pfam PF03838 |
![]() | Protein Recombination protein U (RecU)/PBP related factor A (PrfA) [117632] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117633] (1 PDB entry) Uniprot P39792 34-196 |
![]() | Domain d1rznb_: 1rzn B: [111982] |
PDB Entry: 1rzn (more details), 2.3 Å
SCOPe Domain Sequences for d1rznb_:
Sequence, based on SEQRES records: (download)
>d1rznb_ c.52.1.28 (B:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis [TaxId: 1423]} tleddlnetnkyyltnqiavihkkptpvqivnvhypkrsaavikeayfkqssttdyngiy kgryidfeaketknktsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklf yfwdrkekngrksirkdeleetaypislgyapridyisiieqlyf
>d1rznb_ c.52.1.28 (B:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis [TaxId: 1423]} tleddlnetnkyyltnqiavihkkptpvqeayfkqssttdyngiykgryidfeaketknk tsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklfyfwdrkekngrksir kdeleetaypislgyapridyisiieqlyf
Timeline for d1rznb_: