SCOP 1.71: Domain d1rznb_: 1rzn B:

Lineage for d1rznb_ (1rzn B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families)

5. Family c.52.1.28: RecU-like [117631] (1 protein)
   Pfam 03838

6. Protein Recombination protein U (RecU)/PBP related factor A (PrfA) [117632] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [117633] (1 PDB entry)

8. Domain d1rznb_: 1rzn B: [111982]

Details for d1rznb_

PDB Entry: 1rzn, 2.3 Å

PDB Description: crystal structure of penicillin-binding protein-related factor a from bacillus subtilis.

SCOP Domain Sequences for d1rznb_:

Sequence, based on SEQRES records:

>d1rznb_ c.52.1.28 (B:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis}
tleddlnetnkyyltnqiavihkkptpvqivnvhypkrsaavikeayfkqssttdyngiy
kgryidfeaketknktsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklf
yfwdrkekngrksirkdeleetaypislgyapridyisiieqlyf

Sequence, based on observed residues (ATOM records):

>d1rznb_ c.52.1.28 (B:) Recombination protein U (RecU)/PBP related factor A (PrfA) {Bacillus subtilis}
tleddlnetnkyyltnqiavihkkptpvqeayfkqssttdyngiykgryidfeaketknk
tsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklfyfwdrkekngrksir
kdeleetaypislgyapridyisiieqlyf

Timeline for d1rznb_:

• d1rznb_ is new in SCOP 1.71
  
• d1rznb_ appears in SCOP 1.73
  
• d1rznb_ appears in the current release, SCOPe 2.08