Lineage for d1ryzf_ (1ryz F:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 837625Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 837626Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 837916Protein Uridine phosphorylase [53176] (2 species)
  7. 837994Species Salmonella typhimurium [TaxId:90371] [117656] (1 PDB entry)
    Uniprot P0A1F6
  8. 838000Domain d1ryzf_: 1ryz F: [111980]
    complexed with acy

Details for d1ryzf_

PDB Entry: 1ryz (more details), 2.9 Å

PDB Description: uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution
PDB Compounds: (F:) Uridine phosphorylase

SCOP Domain Sequences for d1ryzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryzf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOP Domain Coordinates for d1ryzf_:

Click to download the PDB-style file with coordinates for d1ryzf_.
(The format of our PDB-style files is described here.)

Timeline for d1ryzf_: