Lineage for d1ryze_ (1ryz E:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 702675Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 702676Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 702963Protein Uridine phosphorylase [53176] (2 species)
  7. 703041Species Salmonella typhimurium [TaxId:90371] [117656] (1 PDB entry)
  8. 703046Domain d1ryze_: 1ryz E: [111979]

Details for d1ryze_

PDB Entry: 1ryz (more details), 2.9 Å

PDB Description: uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution
PDB Compounds: (E:) Uridine phosphorylase

SCOP Domain Sequences for d1ryze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryze_ c.56.2.1 (E:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 602]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOP Domain Coordinates for d1ryze_:

Click to download the PDB-style file with coordinates for d1ryze_.
(The format of our PDB-style files is described here.)

Timeline for d1ryze_: