Lineage for d1ryzc_ (1ryz C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375566Protein Uridine phosphorylase [53176] (5 species)
  7. 1375668Species Salmonella typhimurium [TaxId:90371] [117656] (23 PDB entries)
    Uniprot P0A1F6
  8. 1375786Domain d1ryzc_: 1ryz C: [111977]
    complexed with acy

Details for d1ryzc_

PDB Entry: 1ryz (more details), 2.9 Å

PDB Description: uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d1ryzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryzc_ c.56.2.1 (C:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOPe Domain Coordinates for d1ryzc_:

Click to download the PDB-style file with coordinates for d1ryzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ryzc_: