SCOP 1.75: Domain d1ryzc_: 1ryz C:

Lineage for d1ryzc_ (1ryz C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (1 PDB entry)
   Uniprot P0A1F6

8. Domain d1ryzc_: 1ryz C: [111977]

Details for d1ryzc_

PDB Entry: 1ryz, 2.9 Å

PDB Description: uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution

PDB Compounds: (C:) Uridine phosphorylase

SCOP Domain Sequences for d1ryzc_:

Sequence; same for both SEQRES and ATOM records:

>d1ryzc_ c.56.2.1 (C:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Timeline for d1ryzc_:

• d1ryzc_ first appeared in SCOP 1.71
  
• d1ryzc_ appears in SCOP 1.73
  
• d1ryzc_ appears in SCOPe 2.01
  
• d1ryzc_ appears in the current release, SCOPe 2.08