Lineage for d1ryzc_ (1ryz C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587193Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 587194Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 587466Protein Uridine phosphorylase [53176] (2 species)
  7. 587510Species Salmonella typhimurium [TaxId:90371] [117656] (1 PDB entry)
  8. 587513Domain d1ryzc_: 1ryz C: [111977]

Details for d1ryzc_

PDB Entry: 1ryz (more details), 2.9 Å

PDB Description: uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution

SCOP Domain Sequences for d1ryzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryzc_ c.56.2.1 (C:) Uridine phosphorylase {Salmonella typhimurium}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOP Domain Coordinates for d1ryzc_:

Click to download the PDB-style file with coordinates for d1ryzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ryzc_: