Lineage for d1rywg_ (1ryw G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2563818Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2563828Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2563869Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)
  7. 2563870Species Enterobacter cloacae [TaxId:550] [55212] (12 PDB entries)
    Uniprot P33038
  8. 2563887Domain d1rywg_: 1ryw G: [111973]
    complexed with epu, gol, po4

Details for d1rywg_

PDB Entry: 1ryw (more details), 2.3 Å

PDB Description: c115s mura liganded with reaction products
PDB Compounds: (G:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d1rywg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rywg_ d.68.2.2 (G:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d1rywg_:

Click to download the PDB-style file with coordinates for d1rywg_.
(The format of our PDB-style files is described here.)

Timeline for d1rywg_: