Lineage for d1rywf_ (1ryw F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605490Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 605500Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 605510Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 605533Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 605534Species Enterobacter cloacae [TaxId:550] [55212] (7 PDB entries)
  8. 605564Domain d1rywf_: 1ryw F: [111972]

Details for d1rywf_

PDB Entry: 1ryw (more details), 2.3 Å

PDB Description: c115s mura liganded with reaction products

SCOP Domain Sequences for d1rywf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rywf_ d.68.2.2 (F:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggsaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOP Domain Coordinates for d1rywf_:

Click to download the PDB-style file with coordinates for d1rywf_.
(The format of our PDB-style files is described here.)

Timeline for d1rywf_: