Lineage for d1ry8b_ (1ry8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817793Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 1817794Species Human (Homo sapiens) [TaxId:9606] [102052] (40 PDB entries)
    Uniprot P42330
  8. 1817808Domain d1ry8b_: 1ry8 B: [111966]
    complexed with ndp, rut

Details for d1ry8b_

PDB Entry: 1ry8 (more details), 1.69 Å

PDB Description: prostaglandin f synthase complexed with nadph and rutin
PDB Compounds: (B:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d1ry8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry8b_ c.1.7.1 (B:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
yfnsdsfashpnypysdey

SCOPe Domain Coordinates for d1ry8b_:

Click to download the PDB-style file with coordinates for d1ry8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ry8b_: