Lineage for d1ry0a_ (1ry0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2438076Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2438077Species Human (Homo sapiens) [TaxId:9606] [102052] (50 PDB entries)
    Uniprot P42330
  8. 2438116Domain d1ry0a_: 1ry0 A: [111963]
    complexed with nap, pg2

Details for d1ry0a_

PDB Entry: 1ry0 (more details), 1.69 Å

PDB Description: structure of prostaglandin f synthase with prostaglandin d2
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d1ry0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry0a_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
yfnsdsfashpnypysdey

SCOPe Domain Coordinates for d1ry0a_:

Click to download the PDB-style file with coordinates for d1ry0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry0a_: