Lineage for d1rxla_ (1rxl A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552644Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 552748Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam 04619
  6. 552749Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 552750Species Escherichia coli [TaxId:562] [110077] (5 PDB entries)
  8. 552773Domain d1rxla_: 1rxl A: [111962]

Details for d1rxla_

PDB Entry: 1rxl (more details)

PDB Description: solution structure of the engineered protein afae-dsc

SCOP Domain Sequences for d1rxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxla_ b.2.3.6 (A:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wakdnkqgftpsgttgttkltvt

SCOP Domain Coordinates for d1rxla_:

Click to download the PDB-style file with coordinates for d1rxla_.
(The format of our PDB-style files is described here.)

Timeline for d1rxla_: