Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins) |
Protein Protein tyrosine phosphatase type IVa [102418] (2 species) |
Species Human (Homo sapiens), pr-1 [TaxId:9606] [117578] (1 PDB entry) |
Domain d1rxdc_: 1rxd C: [111961] Structural genomics target |
PDB Entry: 1rxd (more details), 1.9 Å
SCOP Domain Sequences for d1rxdc_:
Sequence, based on SEQRES records: (download)
>d1rxdc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed avqfirqkrrgafnskqllylekyrpkmrlrf
>d1rxdc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav qfirqkrrgafnskqllylekyrpkmrlrf
Timeline for d1rxdc_: