Lineage for d1rxdc_ (1rxd C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875137Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2875138Species Human (Homo sapiens), pr-1 [TaxId:9606] [117578] (1 PDB entry)
    Uniprot Q93096 9-160
  8. 2875141Domain d1rxdc_: 1rxd C: [111961]
    Structural genomics target

Details for d1rxdc_

PDB Entry: 1rxd (more details), 1.9 Å

PDB Description: crystal structure of human protein tyrosine phosphatase 4a1
PDB Compounds: (C:) protein tyrosine phosphatase type IVA, member 1; Protein tyrosine phosphatase IVA1

SCOPe Domain Sequences for d1rxdc_:

Sequence, based on SEQRES records: (download)

>d1rxdc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

Sequence, based on observed residues (ATOM records): (download)

>d1rxdc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav
qfirqkrrgafnskqllylekyrpkmrlrf

SCOPe Domain Coordinates for d1rxdc_:

Click to download the PDB-style file with coordinates for d1rxdc_.
(The format of our PDB-style files is described here.)

Timeline for d1rxdc_: