SCOP 1.73: Domain d1rxdb_: 1rxd B:

Lineage for d1rxdb_ (1rxd B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Protein tyrosine phosphatase type IVa [102418] (2 species)

7. Species Human (Homo sapiens), pr-1 [TaxId:9606] [117578] (1 PDB entry)

8. Domain d1rxdb_: 1rxd B: [111960]

Details for d1rxdb_

PDB Entry: 1rxd, 1.9 Å

PDB Description: crystal structure of human protein tyrosine phosphatase 4a1

PDB Compounds: (B:) protein tyrosine phosphatase type IVA, member 1; Protein tyrosine phosphatase IVA1

SCOP Domain Sequences for d1rxdb_:

Sequence; same for both SEQRES and ATOM records:

>d1rxdb_ c.45.1.1 (B:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

Timeline for d1rxdb_:

• d1rxdb_ first appeared in SCOP 1.71
  
• d1rxdb_ appears in SCOP 1.75
  
• d1rxdb_ appears in the current release, SCOPe 2.08