Lineage for d1rwx.1 (1rwx A:,B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463073Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2463074Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2463075Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2463185Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)
  7. 2463186Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries)
    Uniprot P29466 125-297,317-404
  8. 2463188Domain d1rwx.1: 1rwx A:,B: [111958]
    complexed with ybh

Details for d1rwx.1

PDB Entry: 1rwx (more details), 1.85 Å

PDB Description: Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid
PDB Compounds: (A:) Interleukin-1 beta convertase, (B:) Interleukin-1 beta convertase

SCOPe Domain Sequences for d1rwx.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rwx.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens) [TaxId: 9606]}
npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXa
ikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsf
eqpdgraqmpttervtltrcfylfpgh

SCOPe Domain Coordinates for d1rwx.1:

Click to download the PDB-style file with coordinates for d1rwx.1.
(The format of our PDB-style files is described here.)

Timeline for d1rwx.1: