SCOP 1.71: Domain d1rwx.1: 1rwx A:,B:

Lineage for d1rwx.1 (1rwx A:,B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (2 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)

6. Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries)

8. Domain d1rwx.1: 1rwx A:,B: [111958]
   complexed with ybh

Details for d1rwx.1

PDB Entry: 1rwx, 1.85 Å

PDB Description: Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid

SCOP Domain Sequences for d1rwx.1:

Sequence; same for both SEQRES and ATOM records:

>g1rwx.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
npamptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprr
tgaevditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgi
regicgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXa
ikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsf
eqpdgraqmpttervtltrcfylfpgh

Timeline for d1rwx.1:

• d1rwx.1 is new in SCOP 1.71
  
• d1rwx.1 appears in SCOP 1.73
  
• d1rwx.1 appears in the current release, SCOPe 2.08