![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
![]() | Superfamily c.17.1: Caspase-like [52129] (3 families) ![]() mature protein may be composed of two chains folded in a single domain |
![]() | Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
![]() | Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries) Uniprot P29466 125-297,317-404 |
![]() | Domain d1rww.1: 1rww A:,B: [111957] complexed with oqb |
PDB Entry: 1rww (more details), 2.8 Å
SCOPe Domain Sequences for d1rww.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1rww.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens) [TaxId: 9606]} mptssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtga evditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgireg icgkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikk ahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqp dgraqmpttervtltrcfylfpgh
Timeline for d1rww.1: