Lineage for d1rwua_ (1rwu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955909Superfamily d.58.54: YbeD/HP0495-like [117991] (2 families) (S)
  5. 2955910Family d.58.54.1: YbeD-like [117992] (1 protein)
    Pfam PF04359; DUF493
  6. 2955911Protein Hypothetical protein ybeD [117993] (1 species)
  7. 2955912Species Escherichia coli [TaxId:562] [117994] (1 PDB entry)
    Uniprot P0A8J4
  8. 2955913Domain d1rwua_: 1rwu A: [111955]
    Structural genomics target

Details for d1rwua_

PDB Entry: 1rwu (more details)

PDB Description: solution structure of conserved protein ybed from e. coli
PDB Compounds: (A:) Hypothetical UPF0250 protein ybeD

SCOPe Domain Sequences for d1rwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwua_ d.58.54.1 (A:) Hypothetical protein ybeD {Escherichia coli [TaxId: 562]}
mktklnellefptpftykvmgqalpelvdqvvevvqrhapgdytptvkpsskgnyhsvsi
tinathieqvetlyeelgkidivrmvl

SCOPe Domain Coordinates for d1rwua_:

Click to download the PDB-style file with coordinates for d1rwua_.
(The format of our PDB-style files is described here.)

Timeline for d1rwua_: