| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.54: YbeD/HP0495-like [117991] (2 families) ![]() |
| Family d.58.54.1: YbeD-like [117992] (1 protein) Pfam PF04359; DUF493 |
| Protein Hypothetical protein ybeD [117993] (1 species) |
| Species Escherichia coli [TaxId:562] [117994] (1 PDB entry) Uniprot P0A8J4 |
| Domain d1rwua_: 1rwu A: [111955] Structural genomics target |
PDB Entry: 1rwu (more details)
SCOPe Domain Sequences for d1rwua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwua_ d.58.54.1 (A:) Hypothetical protein ybeD {Escherichia coli [TaxId: 562]}
mktklnellefptpftykvmgqalpelvdqvvevvqrhapgdytptvkpsskgnyhsvsi
tinathieqvetlyeelgkidivrmvl
Timeline for d1rwua_: