SCOP 1.71: Domain d1rwqb2: 1rwq B:509-766

Lineage for d1rwqb2 (1rwq B:509-766)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (11 PDB entries)

8. Domain d1rwqb2: 1rwq B:509-766 [111954]
   Other proteins in same PDB: d1rwqa1, d1rwqb1
   complexed with 5ap, nag

Details for d1rwqb2

PDB Entry: 1rwq, 2.2 Å

PDB Description: human dipeptidyl peptidase iv in complex with 5-aminomethyl-6-(2,4- dichloro-phenyl)-2-(3,5-dimethoxy-phenyl)-pyrimidin-4-ylamine

SCOP Domain Sequences for d1rwqb2:

Sequence; same for both SEQRES and ATOM records:

>d1rwqb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens)}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d1rwqb2:

• d1rwqb2 is new in SCOP 1.71
  
• d1rwqb2 appears in SCOP 1.73
  
• d1rwqb2 appears in the current release, SCOPe 2.08