| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (2 families) ![]() mature protein may be composed of two chains folded in a single domain |
| Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins) |
| Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries) |
| Domain d1rwm.1: 1rwm A:,B: [111947] complexed with q2y |
PDB Entry: 1rwm (more details), 2.7 Å
SCOP Domain Sequences for d1rwm.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1rwm.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikkah
iekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdg
raqmpttervtltrcfylfpgh
Timeline for d1rwm.1: