Lineage for d1rw1a_ (1rw1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854168Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 1854175Protein Hypothetical protein PA3664 (YffB) [117603] (1 species)
  7. 1854176Species Pseudomonas aeruginosa [TaxId:287] [117604] (1 PDB entry)
    Uniprot Q9HXX5
  8. 1854177Domain d1rw1a_: 1rw1 A: [111945]
    Structural genomics target
    complexed with ipa

Details for d1rw1a_

PDB Entry: 1rw1 (more details), 1.02 Å

PDB Description: yffb (pa3664) protein
PDB Compounds: (A:) conserved hypothetical protein yffB

SCOPe Domain Sequences for d1rw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]}
tyvlygikacdtmkkartwldehkvaydfhdykavgidrehlrrwcaehgwqtvlnragt
tfrkldeaqkadldeakaielmlaqpsmikrpvlelggrtlvgfkpdayaaala

SCOPe Domain Coordinates for d1rw1a_:

Click to download the PDB-style file with coordinates for d1rw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1rw1a_: