Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein Hypothetical protein PA3664 (YffB) [117603] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [117604] (1 PDB entry) Uniprot Q9HXX5 |
Domain d1rw1a_: 1rw1 A: [111945] Structural genomics target complexed with ipa |
PDB Entry: 1rw1 (more details), 1.02 Å
SCOPe Domain Sequences for d1rw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} tyvlygikacdtmkkartwldehkvaydfhdykavgidrehlrrwcaehgwqtvlnragt tfrkldeaqkadldeakaielmlaqpsmikrpvlelggrtlvgfkpdayaaala
Timeline for d1rw1a_: