Lineage for d1rutx3 (1rut X:83-113)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750327Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 750400Protein LIM only 4 (Lmo4) [90205] (1 species)
  7. 750401Species Mouse (Mus musculus) [TaxId:10090] [90206] (2 PDB entries)
  8. 750404Domain d1rutx3: 1rut X:83-113 [111941]

Details for d1rutx3

PDB Entry: 1rut (more details), 1.3 Å

PDB Description: complex of lmo4 lim domains 1 and 2 with the ldb1 lid domain
PDB Compounds: (X:) Fusion protein of Lmo4 protein and LIM domain-binding protein 1

SCOP Domain Sequences for d1rutx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]}
nsgacsacgqsipaselvmraqgnvyhlkcf

SCOP Domain Coordinates for d1rutx3:

Click to download the PDB-style file with coordinates for d1rutx3.
(The format of our PDB-style files is described here.)

Timeline for d1rutx3: