Lineage for d1rutx2 (1rut X:49-82)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892525Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 892598Protein LIM only 4 (Lmo4) [90205] (1 species)
  7. 892599Species Mouse (Mus musculus) [TaxId:10090] [90206] (2 PDB entries)
    Uniprot P61969 19-152
  8. 892601Domain d1rutx2: 1rut X:49-82 [111940]
    fusion protein with the LIM domain-binding protein 1 region (Uniprot P70662 300-327)

Details for d1rutx2

PDB Entry: 1rut (more details), 1.3 Å

PDB Description: complex of lmo4 lim domains 1 and 2 with the ldb1 lid domain
PDB Compounds: (X:) Fusion protein of Lmo4 protein and LIM domain-binding protein 1

SCOP Domain Sequences for d1rutx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]}
kcsscqaqlgdigtssytksgmilcrndyirlfg

SCOP Domain Coordinates for d1rutx2:

Click to download the PDB-style file with coordinates for d1rutx2.
(The format of our PDB-style files is described here.)

Timeline for d1rutx2: