Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.1: PCD-like [55248] (2 families) has additional alpha helix at the N-terminus |
Family d.74.1.1: PCD-like [55249] (3 proteins) Pfam PF01329 |
Protein DcoH-like protein DCoH2 [118018] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [118019] (1 PDB entry) Uniprot Q9CZL5 |
Domain d1ru0b_: 1ru0 B: [111938] |
PDB Entry: 1ru0 (more details), 1.6 Å
SCOPe Domain Sequences for d1ru0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ru0b_ d.74.1.1 (B:) DcoH-like protein DCoH2 {Mouse (Mus musculus) [TaxId: 10090]} daqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqaekmnhh pewfnvynkvqitltshdcggltkrdvklaqfiekaaa
Timeline for d1ru0b_: