Lineage for d1ru0b_ (1ru0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524494Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2524495Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2524496Protein DcoH-like protein DCoH2 [118018] (1 species)
  7. 2524497Species Mouse (Mus musculus) [TaxId:10090] [118019] (1 PDB entry)
    Uniprot Q9CZL5
  8. 2524499Domain d1ru0b_: 1ru0 B: [111938]

Details for d1ru0b_

PDB Entry: 1ru0 (more details), 1.6 Å

PDB Description: Crystal structure of DCoH2, a paralog of DCoH, the Dimerization Cofactor of HNF-1
PDB Compounds: (B:) DcoH-like protein DCoHm

SCOPe Domain Sequences for d1ru0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ru0b_ d.74.1.1 (B:) DcoH-like protein DCoH2 {Mouse (Mus musculus) [TaxId: 10090]}
daqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqaekmnhh
pewfnvynkvqitltshdcggltkrdvklaqfiekaaa

SCOPe Domain Coordinates for d1ru0b_:

Click to download the PDB-style file with coordinates for d1ru0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ru0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ru0a_