Lineage for d1rs0a2 (1rs0 A:243-452)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588443Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 588444Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 588445Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 588451Protein Complement factor B domain [102541] (1 species)
  7. 588452Species Human (Homo sapiens) [TaxId:9606] [102542] (4 PDB entries)
  8. 588456Domain d1rs0a2: 1rs0 A:243-452 [111931]
    Other proteins in same PDB: d1rs0a1
    complexed with dfp, iod, mg, na; mutant

Details for d1rs0a2

PDB Entry: 1rs0 (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of the Bb segment of Factor B complexed with Di-isopropyl-phosphate (DIP)

SCOP Domain Sequences for d1rs0a2:

Sequence, based on SEQRES records: (download)

>d1rs0a2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens)}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvckvkdmecledvfyqmidesqslsl

Sequence, based on observed residues (ATOM records): (download)

>d1rs0a2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens)}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpgwnrtrhviilmtdglhn
mggdpitvideirdllyigkdrnpredyldvyvfgvgplvnqvninalaskkdneqhvck
vkdmecledvfyqmidesqslsl

SCOP Domain Coordinates for d1rs0a2:

Click to download the PDB-style file with coordinates for d1rs0a2.
(The format of our PDB-style files is described here.)

Timeline for d1rs0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rs0a1