Lineage for d1rs0a1 (1rs0 A:453-739)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561609Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 561889Protein Factor B [50561] (1 species)
  7. 561890Species Human (Homo sapiens) [TaxId:9606] [50562] (4 PDB entries)
  8. 561895Domain d1rs0a1: 1rs0 A:453-739 [111930]
    Other proteins in same PDB: d1rs0a2
    complexed with dfp, iod, mg, na; mutant

Details for d1rs0a1

PDB Entry: 1rs0 (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of the Bb segment of Factor B complexed with Di-isopropyl-phosphate (DIP)

SCOP Domain Sequences for d1rs0a1:

Sequence, based on SEQRES records: (download)

>d1rs0a1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens)}
cgmvwehrkgtdyhkqpwqakisvirpskghescmgavvseyfvltaahcftvddkehsi
kvsvggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygqtirpicl
pctegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikngdkkgsce
rdaqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsrfiqvgvi
swgvvdvcknqkrqkqvpahardfhinlfqvlpwlkeklqdedlgfl

Sequence, based on observed residues (ATOM records): (download)

>d1rs0a1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens)}
cgmvwehrkgtdyhkqpwqakisvirkghescmgavvseyfvltaahcftvddkehsikv
svggekrdleievvlfhpnyningkkeagipefydydvaliklknklkygqtirpiclpc
tegttralrlpptttcqqqkeellpaqdikalfvseeekkltrkevyikngdkkgscerd
aqyapgydkvkdisevvtprflctggvspyadpntcrgdsggplivhkrsrfiqvgvisw
gvvdvcvpahardfhinlfqvlpwlkeklqdedlgfl

SCOP Domain Coordinates for d1rs0a1:

Click to download the PDB-style file with coordinates for d1rs0a1.
(The format of our PDB-style files is described here.)

Timeline for d1rs0a1:

Domains from same chain:
(mouse over for more information)
d1rs0a2